PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g38965.1.p
Common NameBRADI_4g38965, LOC100831769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 295aa    MW: 32577.7 Da    PI: 8.2521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g38965.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
  Bradi4g38965.1.p 14 KGPWSPEEDRKLKDYIHKFGTGgNWIALPAKAGLKRCGKSCRLRWLNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding36.79.4e-1270111346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++ eEd  +  + +  G++ W+ Ia+ ++ gRt++++k++w++
  Bradi4g38965.1.p  70 GFSDEEDRVICSLYASIGSR-WSVIAAQLP-GRTDNDIKNYWNT 111
                       699*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.437962IPR017930Myb domain
SuperFamilySSF466899.36E-2712109IPR009057Homeodomain-like
SMARTSM007171.5E-121364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-241569IPR009057Homeodomain-like
CDDcd001676.79E-101662No hitNo description
PROSITE profilePS5129420.74963117IPR017930Myb domain
SMARTSM007171.3E-1067115IPR001005SANT/Myb domain
PfamPF002492.1E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGRAPCCDKG SVKKGPWSPE EDRKLKDYIH KFGTGGNWIA LPAKAGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSDEEDRVIC SLYASIGSRW SVIAAQLPGR TDNDIKNYWN TKLKKKLLLN  120
VMSHSHSQIR SSKEPPPPAA AANVGIGGAD DHPPLALFSQ LLLDQQHYHS SSSLMFGIGG  180
DHHHYQQQQQ MAPSSSVFLN DFDLMISSGS GSDGLEQSSI FAGLQLQQQE ELPAADGLMP  240
QLDHHHHHHH HRLYAYGSSY VEDQHEMKPL VIAPSTGSFL YAAATATPGT RYQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239462.10.0PREDICTED: transcription factor RAX2-like
TrEMBLI1IT690.0I1IT69_BRADI; Uncharacterized protein
STRINGBRADI4G38965.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-73myb domain protein 36